DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and clic5a

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001007386.1 Gene:clic5a / 492513 ZFINID:ZDB-GENE-041114-84 Length:246 Species:Danio rerio


Alignment Length:225 Identity:47/225 - (20%)
Similarity:87/225 - (38%) Gaps:53/225 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PNLDLY--------NFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTL 58
            |:::|:        :....|.|:.:.|:....|:..|   :.|::..:...:...:.|....|.|
Zfish    10 PDIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFN---VTTVDLKRKPADLHNLAPGTPPPFL 71

  Fly    59 VDNGFVIWESRAIAVYLVEKYGKPDSP-LYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRT 122
            ..||.|..:...|..:|.|....|..| |...:.:.....|           |...|:...|..|
Zfish    72 TFNGEVRTDVNKIEEFLEEMLAPPKYPKLAAKNKESNTAGN-----------DIFAKFSAYIKNT 125

  Fly   123 G-------KFGDQEALDKVNSAFGFLNTFL--------------EGQDFVAGSQLTVADIVILAT 166
            .       :.|..:.|.|::|   |||:.|              ..:.::.|::||:||..:|..
Zfish   126 KPEANASLEKGLLKVLKKLDS---FLNSPLPDEIDAESTGEEKSSNRKYLDGNELTLADCNLLPK 187

  Fly   167 VSTV-----EWFSFDL-SKFPNVERWLKNA 190
            :..|     ::.:|:: |....|.|:|:||
Zfish   188 LHVVKVVSKKYRNFEIPSDLSGVWRYLQNA 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 15/80 (19%)
GstA 6..188 CDD:223698 43/217 (20%)
GST_C_Delta_Epsilon 92..206 CDD:198287 27/126 (21%)
clic5aNP_001007386.1 GST_N_CLIC 8..97 CDD:239359 18/89 (20%)
O-ClC 10..244 CDD:129941 47/225 (21%)
GST_C_CLIC5 104..244 CDD:198330 27/128 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589658
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.