Sequence 1: | NP_525114.1 | Gene: | GstD7 / 48340 | FlyBaseID: | FBgn0010043 | Length: | 224 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001007373.1 | Gene: | gsto2 / 492500 | ZFINID: | ZDB-GENE-041114-67 | Length: | 240 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 56/206 - (27%) |
---|---|---|---|
Similarity: | 94/206 - (45%) | Gaps: | 37/206 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MPN--LDLYNFPMAPASRAIQMVAKALGLE---LNSKLINTMEGDQLKPE-FVRINPQHTIPTL- 58
Fly 59 VDNGFVIWESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTG 123
Fly 124 KFGDQ---------EALDKVNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTVEWFSFD--L 177
Fly 178 SKFPNVERWLK 188 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD7 | NP_525114.1 | GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 23/77 (30%) |
GstA | 6..188 | CDD:223698 | 54/197 (27%) | ||
GST_C_Delta_Epsilon | 92..206 | CDD:198287 | 24/108 (22%) | ||
gsto2 | NP_001007373.1 | GST_N_Omega | 4..93 | CDD:239353 | 24/81 (30%) |
GstA | 25..210 | CDD:223698 | 54/199 (27%) | ||
GST_C_Omega | 107..229 | CDD:198293 | 24/108 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589476 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |