DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and gsto2

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001007373.1 Gene:gsto2 / 492500 ZFINID:ZDB-GENE-041114-67 Length:240 Species:Danio rerio


Alignment Length:206 Identity:56/206 - (27%)
Similarity:94/206 - (45%) Gaps:37/206 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPN--LDLYNFPMAPASRAIQMVAKALGLE---LNSKLINTMEGDQLKPE-FVRINPQHTIPTL- 58
            :||  :.||:....|.::..::|..|.|::   :|..|::       ||: |::.||..|:|.| 
Zfish    18 VPNGQIRLYSMRFCPFAQRTRLVLTAKGVKHDIININLVS-------KPDWFLKKNPFGTVPVLE 75

  Fly    59 VDNGFVIWESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTG 123
            ..:|.||:||.....||.|.|  |:..|.|:||.:||  .|::..:   ||..:..||:.|....
Zfish    76 TSSGQVIYESPITCEYLDEVY--PEKKLLPSDPFERA--QQKMLLE---LYSKVIPYFYKISMGK 133

  Fly   124 KFGDQ---------EALDKVNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTVEWFSFD--L 177
            |.|:.         |.|.::|.|.....|     .:..|..:|:.|.:|.......|.....  |
Zfish   134 KRGEDVSTAEAEFTEKLLQLNEALANKKT-----KYFGGDSITMIDYLIWPWFERAEMMGVKHCL 193

  Fly   178 SKFPNVERWLK 188
            :|.|.:.:|::
Zfish   194 AKTPELRKWIE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 23/77 (30%)
GstA 6..188 CDD:223698 54/197 (27%)
GST_C_Delta_Epsilon 92..206 CDD:198287 24/108 (22%)
gsto2NP_001007373.1 GST_N_Omega 4..93 CDD:239353 24/81 (30%)
GstA 25..210 CDD:223698 54/199 (27%)
GST_C_Omega 107..229 CDD:198293 24/108 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589476
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.