DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GstD6

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster


Alignment Length:210 Identity:144/210 - (68%)
Similarity:172/210 - (81%) Gaps:1/210 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWES 68
            :||||...:|::||:.|.|||:|:|.||..:||..|:||:|.||:|||||||||||||.|||||:
  Fly     1 MDLYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWET 65

  Fly    69 RAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTGKFGDQEALDK 133
            |||.|||||:|||.|| |||.||||:||||||||||||||||.:.||||.:.||||.|.||.|:|
  Fly    66 RAIVVYLVEQYGKDDS-LYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGKPGTQENLEK 129

  Fly   134 VNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTVEWFSFDLSKFPNVERWLKNAPKVTPGWE 198
            :|:||..||.||:|||:|||:||:||||||||||||.|...|||.|||||:||.|||.||||||:
  Fly   130 LNAAFDLLNNFLDGQDYVAGNQLSVADIVILATVSTTEMVDFDLKKFPNVDRWYKNAQKVTPGWD 194

  Fly   199 QNLESLQQGKKFLQD 213
            :||..:|..||||.:
  Fly   195 ENLARIQSAKKFLAE 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 47/72 (65%)
GstA 6..188 CDD:223698 127/181 (70%)
GST_C_Delta_Epsilon 92..206 CDD:198287 80/113 (71%)
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 47/72 (65%)
PLN02395 11..208 CDD:166036 138/197 (70%)
GST_C_Delta_Epsilon 88..204 CDD:198287 81/115 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468486
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113221at6960
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.