DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GstD5

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster


Alignment Length:217 Identity:136/217 - (62%)
Similarity:166/217 - (76%) Gaps:1/217 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWES 68
            :|.|..|.....|.:.|||||||::||.||:||:|.||||||||::||||||||||||||.||||
  Fly     1 MDFYYSPRGSGCRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWES 65

  Fly    69 RAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTGKFGDQEALDK 133
            |||||||||||||.|: |:|.||:|:||:|||||||||||||:..||::.:|.|||.|..|...|
  Fly    66 RAIAVYLVEKYGKDDT-LFPKDPKKQALVNQRLYFDMGTLYDSFAKYYYPLFHTGKPGSDEDFKK 129

  Fly   134 VNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTVEWFSFDLSKFPNVERWLKNAPKVTPGWE 198
            :.|:|.:||.|||||::|||..||||||.||:||||.|.|.|||:|:|||.||..||.|||||||
  Fly   130 IESSFEYLNIFLEGQNYVAGDHLTVADIAILSTVSTFEIFDFDLNKYPNVARWYANAKKVTPGWE 194

  Fly   199 QNLESLQQGKKFLQDLQAAKEK 220
            :|.:...:.|......|||.::
  Fly   195 ENWKGAVELKGVFDARQAAAKQ 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 51/72 (71%)
GstA 6..188 CDD:223698 121/181 (67%)
GST_C_Delta_Epsilon 92..206 CDD:198287 70/113 (62%)
GstD5NP_524914.3 GstA 1..184 CDD:223698 122/183 (67%)
GST_N_Delta_Epsilon 1..74 CDD:239343 51/72 (71%)
GST_C_Delta_Epsilon 88..204 CDD:198287 70/115 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468495
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113221at6960
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.