DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GstD3

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster


Alignment Length:200 Identity:122/200 - (61%)
Similarity:149/200 - (74%) Gaps:2/200 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 MVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWESRAIAVYLVEKYGKPDS 84
            ||.||||||.|.|:|||::|:|:.|:|::|||||:|||||||||.|||||||.|||||||||.|:
  Fly     1 MVGKALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDA 65

  Fly    85 PLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTGKFGDQEALDKVNSAFGFLNTFLEGQD 149
             |||.|.||:|:|||||||||..:|..|..|::..|.||:||.:|...||...|.||||||||||
  Fly    66 -LYPKDIQKQAVINQRLYFDMALMYPTLANYYYKAFTTGQFGSEEDYKKVQETFDFLNTFLEGQD 129

  Fly   150 FVAGSQLTVADIVILATVSTVEWFSFDLSKFPNVERWLKNAPKVTPGWEQNLESLQQGKKFLQDL 214
            :|||.|.|||||.|||.||..:...||:||:|||.||..:..|:|||||:|.......||.:::.
  Fly   130 YVAGDQYTVADIAILANVSNFDVVGFDISKYPNVARWYDHVKKITPGWEENWAGALDVKKRIEEK 194

  Fly   215 Q-AAK 218
            | |||
  Fly   195 QNAAK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 41/56 (73%)
GstA 6..188 CDD:223698 109/167 (65%)
GST_C_Delta_Epsilon 92..206 CDD:198287 64/113 (57%)
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 41/56 (73%)
GstA 6..173 CDD:223698 105/167 (63%)
GST_C_Delta_Epsilon 72..188 CDD:198287 64/115 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468502
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113221at6960
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.