DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and gstt1

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001006811.1 Gene:gstt1 / 448525 XenbaseID:XB-GENE-998695 Length:242 Species:Xenopus tropicalis


Alignment Length:215 Identity:59/215 - (27%)
Similarity:103/215 - (47%) Gaps:16/215 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPNLDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVI 65
            |..|.||...::...|::.:.|||..:..|:..:...:|:.|..|:.::|....:|.|.|..|.:
 Frog     1 MAELTLYLDLLSQPCRSVYIFAKANNIPFNNHQVRLFKGEHLTEEYGKVNVLRKVPALKDCDFFM 65

  Fly    66 WESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTGKFGDQEA 130
            .||.|:.:|:..|:...|. .||:|.||.|.:::.|.:.........:|.|::...|.....|||
 Frog    66 AESTAMLLYMARKFKTADH-WYPSDIQKCAKVDEYLAWQHTNTRPNGSKVFWVKCLTPLILGQEA 129

  Fly   131 -LDKVNSAFGFLNT--------FLEGQDFVAGSQLTVADIVILATVSTVEWFSFDLSKF---PNV 183
             .:||::.....||        ||..:.|:||.:::|||:|  |.|..::..:..::.|   |.:
 Frog   130 PAEKVDAVVAEFNTTMNNFEEKFLGNKLFIAGDEISVADLV--AIVEIMQVVAGGINVFDDRPKL 192

  Fly   184 ERWLKNAPKVTPGWEQNLES 203
            ..|.|...:.. |.|..||:
 Frog   193 AAWKKRVVEAL-GEELFLEA 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 20/72 (28%)
GstA 6..188 CDD:223698 52/193 (27%)
GST_C_Delta_Epsilon 92..206 CDD:198287 33/124 (27%)
gstt1NP_001006811.1 GST_N_Theta 4..79 CDD:239348 20/74 (27%)
GST_C_Theta 92..217 CDD:198292 32/123 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.