DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and gsto1

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001002621.1 Gene:gsto1 / 436894 ZFINID:ZDB-GENE-040718-365 Length:240 Species:Danio rerio


Alignment Length:207 Identity:57/207 - (27%)
Similarity:96/207 - (46%) Gaps:27/207 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NLDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPE-FVRINPQHTIPTL-VDNGFVI 65
            ::.||:....|.::..::|..|.|::.::..||...    ||: |:..||...:|.| ..:|.||
Zfish    22 HIRLYSMRFCPFAQRTRLVLNAKGIKYDTININLKN----KPDWFLEKNPLGLVPVLETQSGQVI 82

  Fly    66 WESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLI--FRTGKFGDQ 128
            :||.....||.|.|  |:..|.|.||.:||  .||:..:   |:..:|.||:.|  .|| |..|.
Zfish    83 YESPITCEYLDEVY--PEKKLLPFDPFERA--QQRMLLE---LFSKVTPYFYKIPVNRT-KGEDV 139

  Fly   129 EALD-KVNSAFGFLNTFL--EGQDFVAGSQLTVADIVILATVSTVEWFSFDLSKFPNVERWLKNA 190
            .||: ::.......|..|  :...|..|..:|:.|.::        |..|:..:..|::..|...
Zfish   140 SALETELKDKLSQFNEILLKKKSKFFGGDSITMIDYMM--------WPWFERLETMNLKHCLDGT 196

  Fly   191 PKVTPGWEQNLE 202
            |::....|:.:|
Zfish   197 PELKKWTERMME 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 22/74 (30%)
GstA 6..188 CDD:223698 53/188 (28%)
GST_C_Delta_Epsilon 92..206 CDD:198287 28/116 (24%)
gsto1NP_001002621.1 GST_N_Omega 4..93 CDD:239353 21/74 (28%)
GstA 25..210 CDD:223698 57/204 (28%)
GST_C_Omega 107..229 CDD:198293 28/116 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589466
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.