Sequence 1: | NP_525114.1 | Gene: | GstD7 / 48340 | FlyBaseID: | FBgn0010043 | Length: | 224 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002621.1 | Gene: | gsto1 / 436894 | ZFINID: | ZDB-GENE-040718-365 | Length: | 240 | Species: | Danio rerio |
Alignment Length: | 207 | Identity: | 57/207 - (27%) |
---|---|---|---|
Similarity: | 96/207 - (46%) | Gaps: | 27/207 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 NLDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPE-FVRINPQHTIPTL-VDNGFVI 65
Fly 66 WESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLI--FRTGKFGDQ 128
Fly 129 EALD-KVNSAFGFLNTFL--EGQDFVAGSQLTVADIVILATVSTVEWFSFDLSKFPNVERWLKNA 190
Fly 191 PKVTPGWEQNLE 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD7 | NP_525114.1 | GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 22/74 (30%) |
GstA | 6..188 | CDD:223698 | 53/188 (28%) | ||
GST_C_Delta_Epsilon | 92..206 | CDD:198287 | 28/116 (24%) | ||
gsto1 | NP_001002621.1 | GST_N_Omega | 4..93 | CDD:239353 | 21/74 (28%) |
GstA | 25..210 | CDD:223698 | 57/204 (28%) | ||
GST_C_Omega | 107..229 | CDD:198293 | 28/116 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589466 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |