DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GstD11

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster


Alignment Length:219 Identity:96/219 - (43%)
Similarity:131/219 - (59%) Gaps:14/219 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWESRA 70
            ||..|.:|..|:|.::||.|.::...|::|.:||:||||:||.:||||.:||:.|.|.|:|||||
  Fly    27 LYYLPPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWESRA 91

  Fly    71 IAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTGKFGDQEALDKVN 135
            |..|||..|||.|. |||.|.:.|||::|||.||:||||..||.|:|.....|...|:....|:.
  Fly    92 ILSYLVAAYGKSDQ-LYPTDIRVRALVDQRLQFDLGTLYMRLTDYYFPTMFIGAPLDEGKRAKLA 155

  Fly   136 SAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTVEWFSFDLSKFPNVERWLKN-----APKVTP 195
            .|.|:|||.|||:.|.|....|:||:.:|.|||.:|.|.|:|..:.::.:||..     ||    
  Fly   156 EAVGWLNTILEGRQFSAADHFTIADLTLLVTVSQLEAFEFELRPYKHIRQWLDRCKDHMAP---- 216

  Fly   196 GWEQNLESLQQGK-KFLQDLQAAK 218
               .:.|.|...| ..|.|:..||
  Fly   217 ---FDYEELNANKANMLADMFKAK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 36/70 (51%)
GstA 6..188 CDD:223698 86/181 (48%)
GST_C_Delta_Epsilon 92..206 CDD:198287 46/118 (39%)
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 36/70 (51%)
GST_C_Delta_Epsilon 112..231 CDD:198287 47/125 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113221at6960
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.