DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GstD1

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster


Alignment Length:210 Identity:124/210 - (59%)
Similarity:154/210 - (73%) Gaps:3/210 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWES 68
            :|.|..|.:...|::.|.|||:|:|||.||:|...|:.|||||::|||||||||||||||.:|||
  Fly     2 VDFYYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWES 66

  Fly    69 RAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFF-LIFRTGKFGDQEALD 132
            |||.|||||||||.|| |||..|:|||:|||||||||||||.:...|:: .:|.... .|.||..
  Fly    67 RAIQVYLVEKYGKTDS-LYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAP-ADPEAFK 129

  Fly   133 KVNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTVEWFSFDLSKFPNVERWLKNAPKVTPGW 197
            |:.:||.||||||||||:.||..||||||.::|||||.|...|::||:.||.||.:||.||||||
  Fly   130 KIEAAFEFLNTFLEGQDYAAGDSLTVADIALVATVSTFEVAKFEISKYANVNRWYENAKKVTPGW 194

  Fly   198 EQNLESLQQGKKFLQ 212
            |:|.....:.||:.:
  Fly   195 EENWAGCLEFKKYFE 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 45/72 (63%)
GstA 6..188 CDD:223698 111/182 (61%)
GST_C_Delta_Epsilon 92..206 CDD:198287 65/114 (57%)
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 45/72 (63%)
GstA 4..185 CDD:223698 111/182 (61%)
GST_C_Delta_Epsilon 89..205 CDD:198287 65/116 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468496
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113221at6960
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.