DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GstZ2

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster


Alignment Length:202 Identity:44/202 - (21%)
Similarity:85/202 - (42%) Gaps:28/202 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYNFPMAPASRAIQMVAKALGLELNSKLINTME--GDQLKPEFVRINPQHTIPTLVDNGFVIWES 68
            ||::..:..|..:::......:..:.|.|:.::  |:|...|:..:||...:|.|..:|..:.||
  Fly    18 LYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDGHTLIES 82

  Fly    69 RAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTGKFGDQE---- 129
            .||..||.|.  :|..||.|.|..|||.:.:.:......:..  .:...::...|:...:|    
  Fly    83 VAIMHYLEET--RPQRPLLPQDVHKRAKVREIVEIICSGIQP--LQNLIVLIHVGEEKKKEWAQH 143

  Fly   130 -------ALDKVNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTVEWFSFDLSKFP---NVE 184
                   |::|..|.        ....:..|.::::||..::..|.....|..||..:|   .::
  Fly   144 WITRGFRAVEKALST--------SAGKYCVGDEISMADCCLVPQVFNARRFHVDLRPYPIILRID 200

  Fly   185 RWLKNAP 191
            |.|::.|
  Fly   201 RELESNP 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 19/72 (26%)
GstA 6..188 CDD:223698 42/197 (21%)
GST_C_Delta_Epsilon 92..206 CDD:198287 19/114 (17%)
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 18/71 (25%)
maiA 17..221 CDD:273527 44/202 (22%)
GST_C_Zeta 104..217 CDD:198300 19/114 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460380
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.