DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and clic5b

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_998062.1 Gene:clic5b / 405833 ZFINID:ZDB-GENE-040426-2542 Length:408 Species:Danio rerio


Alignment Length:204 Identity:47/204 - (23%)
Similarity:77/204 - (37%) Gaps:41/204 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWESRAIAVYLVE 77
            |.|:.:.|:....|:..|   :.|::..:...:...:.|....|.|..||.|..:...|..:|.|
Zfish   191 PFSQRLFMILWLKGVVFN---VTTVDLKRKPADLHNLAPGTHPPFLTFNGEVKTDVNKIEEFLEE 252

  Fly    78 KYGKPDSP-LYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTGKFGDQEALDK-VNSAFGF 140
            ....|..| |.....:..|..|           |...|:...|..| |....|||:| :..|...
Zfish   253 VLAPPKYPKLAARHRESNAAGN-----------DIFAKFSAFIKNT-KPDANEALEKGLTKALKK 305

  Fly   141 LNTFL------------------EGQDFVAGSQLTVADIVILATVSTV-----EWFSFDL-SKFP 181
            |:.:|                  ..:.|:.|:.||:||..:|..:..|     ::.:||: |...
Zfish   306 LDEYLNSPLPDEVDADSMEEEKASNRRFLDGNDLTLADCNLLPKLHIVKVVAKKYRNFDIPSDLT 370

  Fly   182 NVERWLKNA 190
            .|.|:|.:|
Zfish   371 GVWRYLNSA 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 14/63 (22%)
GstA 6..188 CDD:223698 45/200 (23%)
GST_C_Delta_Epsilon 92..206 CDD:198287 29/124 (23%)
clic5bNP_998062.1 GST_N_CLIC 170..259 CDD:239359 16/70 (23%)
O-ClC 172..407 CDD:129941 47/204 (23%)
GST_C_CLIC5 266..406 CDD:198330 29/126 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589659
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.