DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and gstt1b

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_956878.1 Gene:gstt1b / 393556 ZFINID:ZDB-GENE-040426-1491 Length:242 Species:Danio rerio


Alignment Length:240 Identity:71/240 - (29%)
Similarity:118/240 - (49%) Gaps:28/240 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWES 68
            |||::.|    .|::.:.||...::.:.|.|:..||.|...||.:|||....||:.|..|.:.||
Zfish     7 LDLFSQP----CRSVYIFAKKNNIQFDYKKISLFEGYQYGEEFGKINPLRKFPTIKDGDFCLAES 67

  Fly    69 RAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTK-YFFLIFRTGKFGDQEALD 132
            .||.:||.:|:..||. .:|.|.||||.:|:.|.:...::.....| .:|.|......|.:...:
Zfish    68 VAIMIYLADKFHTPDH-WFPADLQKRARVNEYLSWQHTSIRMHGAKIIWFKILIPEVLGAEVPKE 131

  Fly   133 KVNSAFGFLNT--------FLEGQDFVAGSQLTVADIVILATVSTVEWFSFDLSKF---PNVERW 186
            |:.:|...||.        ||:.:.|:.|.|:::||:|  |.|..::.|:..:..|   |.::.|
Zfish   132 KMENAEENLNVALQLFQDKFLQDKPFIVGDQISLADLV--AIVEIMQPFAAGMDVFENRPKLKAW 194

  Fly   187 LKNAPKVTPGWE------QNLESLQQGKKFL--QDLQAAKEKEVK 223
             |:..:|..|.:      |...||:...|.:  :.|...|:|.:|
Zfish   195 -KDRVRVAIGAKLFDEAHQATMSLRDNAKIIDPKGLSPLKDKILK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 27/72 (38%)
GstA 6..188 CDD:223698 58/193 (30%)
GST_C_Delta_Epsilon 92..206 CDD:198287 34/131 (26%)
gstt1bNP_956878.1 GstA 1..199 CDD:223698 61/199 (31%)
GST_N_Theta 3..78 CDD:239348 27/74 (36%)
GST_C_Theta 91..217 CDD:198292 31/128 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.