DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GstO1

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster


Alignment Length:122 Identity:35/122 - (28%)
Similarity:56/122 - (45%) Gaps:16/122 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPE-FVRINPQHTIPTL----VDNGF 63
            |.||:....|.:..:.:|..|..:..::..||..:    ||| |..::....:|.|    .....
  Fly    22 LKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRD----KPEWFSLVSSSTKVPALELVKEQGNP 82

  Fly    64 VIWESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFD-MGTLYDALTKYFFLI 119
            |:.||..|..||.|||  |:.||||.|..|:|  .:::..: .|...:|.  |:.|:
  Fly    83 VLIESLIICDYLDEKY--PEVPLYPKDLLKKA--QEKILIERFGQFINAF--YYLLL 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 20/77 (26%)
GstA 6..188 CDD:223698 34/120 (28%)
GST_C_Delta_Epsilon 92..206 CDD:198287 6/29 (21%)
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 19/76 (25%)
GstA 22..216 CDD:223698 35/122 (29%)
GST_C_Omega 109..234 CDD:198293 6/29 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460147
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.