DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GstE11

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster


Alignment Length:222 Identity:79/222 - (35%)
Similarity:125/222 - (56%) Gaps:9/222 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWESRA 70
            ||..|.:|..||:.:.|.||||||:.:|:|...|:....||:::|.|||||.|.|||.::.:|..
  Fly     7 LYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHI 71

  Fly    71 IAVYLVEKYG-KPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTGKFGDQEA-LDK 133
            |..||.:||. :.|..|||.||:||.|::.|||:|.|.|:..:.   |::.....||..|. .|:
  Fly    72 ICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIR---FIVEPVIYFGAGEVPSDR 133

  Fly   134 V---NSAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTVEWFS-FDLSKFPNVERWLKNAPKVT 194
            |   ..|:..|...|...|::.|.:||:||:..:|:|||.|.|: .:..:||.:.:|:|....:.
  Fly   134 VAYLQKAYDGLEHCLAEGDYLVGDKLTIADLSCIASVSTAEAFAPIEPDQFPRLVQWVKRIQALP 198

  Fly   195 PGWEQNLESLQQGKKFLQDLQAAKEKE 221
            ...:.|.|.|......::.|.|.::::
  Fly   199 YYQKNNQEGLDMLVGLVKGLLAERQQK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 32/70 (46%)
GstA 6..188 CDD:223698 73/187 (39%)
GST_C_Delta_Epsilon 92..206 CDD:198287 37/118 (31%)
GstE11NP_001286575.1 GstA 5..198 CDD:223698 74/193 (38%)
GST_N_Delta_Epsilon 5..78 CDD:239343 32/70 (46%)
GST_C_Delta_Epsilon 94..211 CDD:198287 37/119 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460339
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.