DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GstE7

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_611329.1 Gene:GstE7 / 37112 FlyBaseID:FBgn0063493 Length:223 Species:Drosophila melanogaster


Alignment Length:220 Identity:85/220 - (38%)
Similarity:126/220 - (57%) Gaps:12/220 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPNLDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVI 65
            ||.|.||....:|..||:::...||.:......:||...:....||::.|||||:|||.|:|..|
  Fly     1 MPKLILYGLEASPPVRAVKLTLAALEVPYEFVEVNTRAKENFSEEFLKKNPQHTVPTLEDDGHYI 65

  Fly    66 WESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLY----DALTKYFFLIFRTGK-- 124
            |:|.||..|||.||||.|| |||.|..:||:::|||:|:.|.::    .::||..|    .||  
  Fly    66 WDSHAIIAYLVSKYGKTDS-LYPKDLLQRAVVDQRLHFESGVIFANALRSITKPLF----AGKQT 125

  Fly   125 FGDQEALDKVNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTVEWF-SFDLSKFPNVERWLK 188
            ...:|..|.:...:.||..||.|.|:|||:|||:||..|::|||::|.| ..|.:|:|.:..|.|
  Fly   126 MIPKERYDAIIEVYDFLEKFLAGNDYVAGNQLTIADFSIISTVSSLEVFVKVDTTKYPRIAAWFK 190

  Fly   189 NAPKVTPGWEQNLESLQQGKKFLQD 213
            ...|:....|.|....:..:.|:::
  Fly   191 RLQKLPYYEEANGNGARTFESFIRE 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 29/72 (40%)
GstA 6..188 CDD:223698 77/188 (41%)
GST_C_Delta_Epsilon 92..206 CDD:198287 42/120 (35%)
GstE7NP_611329.1 GstA 4..196 CDD:223698 80/196 (41%)
GST_N_Delta_Epsilon 4..77 CDD:239343 29/72 (40%)
GST_C_Delta_Epsilon 91..209 CDD:198287 42/121 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460334
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.