DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GstE6

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster


Alignment Length:211 Identity:77/211 - (36%)
Similarity:129/211 - (61%) Gaps:8/211 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPNLDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVI 65
            |..|.||....:|..||:::...||.|......::.:...||.||::..|||||:|||.|:|..|
  Fly     1 MVKLTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYI 65

  Fly    66 WESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLY----DALTKYFFLIFRTGKFG 126
            |:|.||..|||.||...|: |||.||.|||:::|||:|:.|.::    .:::|  .::|:.....
  Fly    66 WDSHAIIAYLVSKYADSDA-LYPKDPLKRAVVDQRLHFESGVVFANGIRSISK--SVLFQGQTKV 127

  Fly   127 DQEALDKVNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTVEWF-SFDLSKFPNVERWLKNA 190
            .:|..|.:...:.|:.|||:|||::||:|||:||..::::|:::|.| :.|.:|:|.:..|:|..
  Fly   128 PKERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKL 192

  Fly   191 PKVTPGWEQNLESLQQ 206
            .::....|.|.:.::|
  Fly   193 EQLPYYEEANGKGVRQ 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 30/72 (42%)
GstA 6..188 CDD:223698 71/186 (38%)
GST_C_Delta_Epsilon 92..206 CDD:198287 36/118 (31%)
GstE6NP_611328.1 GstA 4..196 CDD:223698 73/194 (38%)
GST_N_Delta_Epsilon 4..77 CDD:239343 30/72 (42%)
GST_C_Delta_Epsilon 91..209 CDD:198287 37/120 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460337
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.