DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GstE4

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster


Alignment Length:229 Identity:77/229 - (33%)
Similarity:124/229 - (54%) Gaps:22/229 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPNLDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVI 65
            |..:.||....:|.:||..:..|||.|......:|..|.:....:|.:.|||||:|.|.|:...|
  Fly     1 MGKISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACI 65

  Fly    66 WESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDA----LTKYFFLIFRTGKFG 126
            |:|.||..||||||. |...|||.|..:||.::|.::|:.|.::::    ||:.  ::|    ||
  Fly    66 WDSHAIMAYLVEKYA-PSDELYPKDLLQRAKVDQLMHFESGVIFESALRRLTRP--VLF----FG 123

  Fly   127 D----QEALDKVNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTVEWF-SFDLSKFPNVERW 186
            :    :..:|.:...:.|:.|||:..|||||.|||:||..|::|::::..| ..|.:|:|.:..|
  Fly   124 EPTLPRNQVDHILQVYDFVETFLDDHDFVAGDQLTIADFSIVSTITSIGVFLELDPAKYPKIAAW 188

  Fly   187 LKNAPKVTPGWEQNLESLQQGKKFLQDLQAAKEK 220
            |:.. |..|.:|:     ..||...|.::..:.|
  Fly   189 LERL-KELPYYEE-----ANGKGAAQFVELLRSK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 27/72 (38%)
GstA 6..188 CDD:223698 68/190 (36%)
GST_C_Delta_Epsilon 92..206 CDD:198287 36/122 (30%)
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 27/72 (38%)
GstA 6..196 CDD:223698 70/197 (36%)
GST_C_Delta_Epsilon 91..209 CDD:198287 38/129 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460329
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.