DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GstE3

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster


Alignment Length:225 Identity:82/225 - (36%)
Similarity:128/225 - (56%) Gaps:13/225 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPNLDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVI 65
            |..|.||....:|..|::.:..:||.|:.:.|::|.||.:.|||||::|||.||:|.|.||||.:
  Fly     1 MGKLTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYL 65

  Fly    66 WESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTGKFG-DQE 129
            .:|.||..|||.|||:.|| |||.|.:|||:::|||::|...:........|.:|...|.. .|.
  Fly    66 ADSHAINSYLVSKYGRNDS-LYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFWENKTEIPQA 129

  Fly   130 ALDKVNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTVEWFSF---DLSKFPNVERWLKNAP 191
            .:|.:...:..||.|||..:::||..||:||..::|.::  .:|.|   |.:|:|.:..|:|.. 
  Fly   130 RIDALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGLT--GFFVFLPVDATKYPELAAWIKRI- 191

  Fly   192 KVTPGWEQNLESLQQGKKFLQDLQAAKEKE 221
            |..|.:|:     ..|.:..|.::..|.|:
  Fly   192 KELPYYEE-----ANGSRAAQIIEFIKSKK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 33/72 (46%)
GstA 6..188 CDD:223698 72/185 (39%)
GST_C_Delta_Epsilon 92..206 CDD:198287 34/117 (29%)
GstE3NP_611325.2 GstA 4..195 CDD:223698 75/194 (39%)
GST_N_Delta_Epsilon 4..77 CDD:239343 33/72 (46%)
GST_C_Delta_Epsilon 91..208 CDD:198287 35/124 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460330
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.