DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GstE2

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_611324.1 Gene:GstE2 / 37107 FlyBaseID:FBgn0063498 Length:221 Species:Drosophila melanogaster


Alignment Length:217 Identity:81/217 - (37%)
Similarity:117/217 - (53%) Gaps:12/217 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWES 68
            |.||...::|..||.::..:||.|:...|.::.:.||..|..|::.|||||:|.|.|||.:||:|
  Fly     5 LVLYGMDISPPVRACKLTLRALNLDYEYKEMDLLAGDHFKDAFLKKNPQHTVPLLEDNGALIWDS 69

  Fly    69 RAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTK----YFFLIFRTGKFGDQE 129
            .||..|||:||...|. |||.|...||.::|||:||...|:.:|..    ||   .|......:|
  Fly    70 HAIVCYLVDKYANSDE-LYPRDLVLRAQVDQRLFFDASILFMSLRNVSIPYF---LRQVSLVPKE 130

  Fly   130 ALDKVNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTV-EWFSFDLSKFPNVERWLKNAPKV 193
            .:|.:..|:|.|..||....::.|||||:||:...||.|:: .....|..|:|.|..|.:...|:
  Fly   131 KVDNIKDAYGHLENFLGDNPYLTGSQLTIADLCCGATASSLAAVLDLDELKYPKVAAWFERLSKL 195

  Fly   194 TPGWEQNLESLQQGKKFLQDLQ 215
            ....|.||..|   ||::..|:
  Fly   196 PHYEEDNLRGL---KKYINLLK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 31/72 (43%)
GstA 6..188 CDD:223698 72/186 (39%)
GST_C_Delta_Epsilon 92..206 CDD:198287 39/118 (33%)
GstE2NP_611324.1 GstA 5..196 CDD:223698 74/194 (38%)
GST_N_Delta_Epsilon 5..78 CDD:239343 31/72 (43%)
GST_C_Delta_Epsilon 94..209 CDD:198287 40/120 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460332
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.