DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GstE10

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster


Alignment Length:228 Identity:85/228 - (37%)
Similarity:117/228 - (51%) Gaps:31/228 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPNLDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVI 65
            |.||.||....:|..||:.:..:||.|:.....::...||.|||:.:|.|||||:|.|.|....|
  Fly     1 MANLILYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGESCI 65

  Fly    66 WESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTGKFGDQEA 130
            |:|.||..|||.||.:.|. |||.||.|||:::|||:|:.|.|:..:.|..           |.|
  Fly    66 WDSHAIIGYLVNKYAQSDE-LYPKDPLKRAVVDQRLHFETGVLFHGIFKQL-----------QRA 118

  Fly   131 LDKVNS-------------AFGFLNTFLEGQDFVAGSQLTVADIVILATVST--VEWFSFDLSKF 180
            |.|.|:             |:..|..||....:|||.|||:||..|:|||||  :.:...|.:|:
  Fly   119 LFKENATEVPKDRLAELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKY 183

  Fly   181 PNVERWLKNAPKVTPGWEQNLESLQQGKKFLQD 213
            |.:..||.....:....|.||    :|.:.|.|
  Fly   184 PKLSAWLARISALPFYEEDNL----RGARLLAD 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 30/72 (42%)
GstA 6..188 CDD:223698 75/196 (38%)
GST_C_Delta_Epsilon 92..206 CDD:198287 41/128 (32%)
GstE10NP_001286570.1 GstA 4..197 CDD:223698 77/204 (38%)
GST_N_Delta_Epsilon 4..77 CDD:239343 30/72 (42%)
GST_C_Delta_Epsilon 91..211 CDD:198287 42/134 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460327
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.