DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GstE13

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster


Alignment Length:228 Identity:76/228 - (33%)
Similarity:126/228 - (55%) Gaps:17/228 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVD-NGFVIWESR 69
            ||....:|.:||..:|||.:||:|..|.::..:.:.|..|||::||||.||..|| :|.|..:|.
  Fly     6 LYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSH 70

  Fly    70 AIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTGKFGDQE----A 130
            ||..:||.||...|. |||.|.::||.|:.|::::.|.|:..:..   ::.|....|:.|    :
  Fly    71 AIVCFLVAKYAGNDQ-LYPRDLKRRAHIDHRMHYENGVLFQVVKD---IVARNIYGGEGEYNPRS 131

  Fly   131 LDKVNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTVE-WFSFDLSKFPNVERWLKNAPKVT 194
            |...::|:..|..||:...||.|::|:|||:.|..|:.|:: ....:..|:|..::|::...|:.
  Fly   132 LTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKYPQTKQWMERMDKLL 196

  Fly   195 PGWEQ-NLESLQQGKKFLQD--LQAAKEKEVKA 224
            |..|: ||    :|.:.||.  |....|.:.|:
  Fly   197 PDNEEINL----KGARALQTRILSCMAENKAKS 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 30/71 (42%)
GstA 6..188 CDD:223698 65/187 (35%)
GST_C_Delta_Epsilon 92..206 CDD:198287 32/119 (27%)
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 30/71 (42%)
GST_C_Delta_Epsilon 92..211 CDD:198287 33/125 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460333
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.