DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GstT3

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster


Alignment Length:195 Identity:52/195 - (26%)
Similarity:86/195 - (44%) Gaps:24/195 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVR-INPQHTIPTLVDNGFVIWESRAIAVY 74
            |:..|||:.::.:...:.....::....|:.|..:|.: ||....:|.:.|||:.:.||.||..|
  Fly    52 MSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESVAILRY 116

  Fly    75 LVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIF---------------RTGK 124
            |..| ||....|||.....::.:::.|.:...:|......||..::               .|.:
  Fly   117 LSAK-GKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTPSEAKIETFR 180

  Fly   125 FGDQEALDKVNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTVEWFSFDLS-KFPNVERWLK 188
            ...:..||.|.      ..:|||:||:.||.||||||.....:.......:|:. |:|.:..|||
  Fly   181 MQMERNLDVVE------EVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYDVRIKYPKIRAWLK 239

  Fly   189  188
              Fly   240  239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 19/66 (29%)
GstA 6..188 CDD:223698 50/193 (26%)
GST_C_Delta_Epsilon 92..206 CDD:198287 27/113 (24%)
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 20/69 (29%)
GstA 47..243 CDD:223698 52/195 (27%)
GST_C_Theta 135..259 CDD:198292 27/111 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460049
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.