DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and clic1

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_997847.1 Gene:clic1 / 324481 ZFINID:ZDB-GENE-030131-3202 Length:241 Species:Danio rerio


Alignment Length:202 Identity:40/202 - (19%)
Similarity:76/202 - (37%) Gaps:51/202 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PNLDLY--------NFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVR-INPQHTIPT 57
            |.::|:        :....|.|:.:.||....|:..|   :.|::..: |||.:: :.|....|.
Zfish     6 PEVELFVKAGSDGQSIGNCPFSQRLFMVLWLKGVTFN---VTTVDMKR-KPEILKDLAPGAQPPF 66

  Fly    58 LVDNGFVIWESRAIAVYLVEKYGKPDSP-----------------------LYPNDPQKRALINQ 99
            |:....|..::..|..:|.|....|..|                       :..::||....:.:
Zfish    67 LLYGTEVKTDTNKIEEFLEETLCPPKYPRLAACNPESNTAGLDVFSKFSAYIKNSNPQMNDNLEK 131

  Fly   100 RLYFDMGTLYDALTKYFFLIFRTGKFGDQEALDKVNSAFGFLNTFLEGQDFVAGSQLTVADIVIL 164
            .|...:..|.|.|:...     ..:..:..|.|.::|.    .:||:||      :||:||..:|
Zfish   132 GLLKALKKLDDYLSSPL-----PDEIDENSADDVISST----RSFLDGQ------ELTLADCNLL 181

  Fly   165 ATVSTVE 171
            ..:..|:
Zfish   182 PKLHIVK 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 17/81 (21%)
GstA 6..188 CDD:223698 39/198 (20%)
GST_C_Delta_Epsilon 92..206 CDD:198287 18/80 (23%)
clic1NP_997847.1 GST_N_CLIC 3..93 CDD:239359 20/90 (22%)
O-ClC 6..241 CDD:129941 40/202 (20%)
GST_C_CLIC1 100..238 CDD:198333 19/104 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589640
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.