Sequence 1: | NP_525114.1 | Gene: | GstD7 / 48340 | FlyBaseID: | FBgn0010043 | Length: | 224 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_997847.1 | Gene: | clic1 / 324481 | ZFINID: | ZDB-GENE-030131-3202 | Length: | 241 | Species: | Danio rerio |
Alignment Length: | 202 | Identity: | 40/202 - (19%) |
---|---|---|---|
Similarity: | 76/202 - (37%) | Gaps: | 51/202 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 PNLDLY--------NFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVR-INPQHTIPT 57
Fly 58 LVDNGFVIWESRAIAVYLVEKYGKPDSP-----------------------LYPNDPQKRALINQ 99
Fly 100 RLYFDMGTLYDALTKYFFLIFRTGKFGDQEALDKVNSAFGFLNTFLEGQDFVAGSQLTVADIVIL 164
Fly 165 ATVSTVE 171 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD7 | NP_525114.1 | GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 17/81 (21%) |
GstA | 6..188 | CDD:223698 | 39/198 (20%) | ||
GST_C_Delta_Epsilon | 92..206 | CDD:198287 | 18/80 (23%) | ||
clic1 | NP_997847.1 | GST_N_CLIC | 3..93 | CDD:239359 | 20/90 (22%) |
O-ClC | 6..241 | CDD:129941 | 40/202 (20%) | ||
GST_C_CLIC1 | 100..238 | CDD:198333 | 19/104 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589640 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |