DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and Clic

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster


Alignment Length:158 Identity:37/158 - (23%)
Similarity:62/158 - (39%) Gaps:51/158 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHT-IPTLVDNGFVIWE 67
            :|||            ::|:   |:..|..:.|::..:..|:| |.|.:.| .|.|:|||..|.|
  Fly    48 MDLY------------LLAE---LKTISLKVTTVDMQKPPPDF-RTNFEATHPPILIDNGLAILE 96

  Fly    68 SRAIAVYLVEK----YGKPDSPLYPNDPQKRALINQRLYFDMGTLY--------DALTKYFFLIF 120
            :..|..::::.    |.     |:..|.:...|| :.||..:..:.        :||..:     
  Fly    97 NEKIERHIMKNIPGGYN-----LFVQDKEVATLI-ENLYVKLKLMLVKKDEAKNNALLSH----- 150

  Fly   121 RTGKFGDQEALDKVNSAFGFLNT-FLEG 147
                      |.|:|......|| ||.|
  Fly   151 ----------LRKINDHLSARNTRFLTG 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 20/73 (27%)
GstA 6..188 CDD:223698 36/156 (23%)
GST_C_Delta_Epsilon 92..206 CDD:198287 14/65 (22%)
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 20/79 (25%)
O-ClC 21..231 CDD:129941 37/158 (23%)
GST_C_CLIC 118..232 CDD:198307 15/67 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460361
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.