DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and Gdap1l1

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_038961050.1 Gene:Gdap1l1 / 311616 RGDID:1304960 Length:369 Species:Rattus norvegicus


Alignment Length:266 Identity:50/266 - (18%)
Similarity:98/266 - (36%) Gaps:78/266 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NLDLYNFPMAPASR---AIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFV 64
            :|.||::..:.:|:   .:::|....||....:.::..:.:..:|.|:|:|....:|.::....:
  Rat    46 SLVLYHWTQSFSSQKHLQVRLVIAEKGLSCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNI 110

  Fly    65 IWESRAIAVYLVEKY-GKPDSPLYP--NDPQKRALINQR-----LYFDMGT----LYDALT---- 113
            |.:...|..|:...: |:....|.|  ..||...::..|     |..|..|    |:..||    
  Rat   111 ISDYDQIIDYVERTFTGEHVVALMPEAGSPQHARVLQYRELLDALPMDAYTHGCILHPELTTDSM 175

  Fly   114 --KYFFLIFRTG---------KFGDQE-------------ALDKV--NSAFGFLNTFL------- 145
              ||.....|..         |...:|             .:.|:  :...|:|...|       
  Rat   176 IPKYATAEIRRHLANATTDLMKLDHEEPQLSEPYLSKQKKLMAKILEHDDVGYLKKILGELAMVL 240

  Fly   146 --------------EGQD---FVAGSQLTVADIVILATVSTVEWFSFDLSK-------FPNVERW 186
                          |||.   ::.|...|:||:::.||:..:::..  |||       .||::.:
  Rat   241 DQIEAELEKRKLENEGQTCELWLCGCAFTLADVLLGATLHRLKFLG--LSKKYWEDGSRPNLQSF 303

  Fly   187 LKNAPK 192
            .:...:
  Rat   304 FERVQR 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 15/75 (20%)
GstA 6..188 CDD:223698 49/257 (19%)
GST_C_Delta_Epsilon 92..206 CDD:198287 31/171 (18%)
Gdap1l1XP_038961050.1 Thioredoxin_like 47..122 CDD:412351 15/74 (20%)
GST_C_family 203..313 CDD:413470 18/109 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348209
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.