Sequence 1: | NP_525114.1 | Gene: | GstD7 / 48340 | FlyBaseID: | FBgn0010043 | Length: | 224 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038961050.1 | Gene: | Gdap1l1 / 311616 | RGDID: | 1304960 | Length: | 369 | Species: | Rattus norvegicus |
Alignment Length: | 266 | Identity: | 50/266 - (18%) |
---|---|---|---|
Similarity: | 98/266 - (36%) | Gaps: | 78/266 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 NLDLYNFPMAPASR---AIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFV 64
Fly 65 IWESRAIAVYLVEKY-GKPDSPLYP--NDPQKRALINQR-----LYFDMGT----LYDALT---- 113
Fly 114 --KYFFLIFRTG---------KFGDQE-------------ALDKV--NSAFGFLNTFL------- 145
Fly 146 --------------EGQD---FVAGSQLTVADIVILATVSTVEWFSFDLSK-------FPNVERW 186
Fly 187 LKNAPK 192 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD7 | NP_525114.1 | GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 15/75 (20%) |
GstA | 6..188 | CDD:223698 | 49/257 (19%) | ||
GST_C_Delta_Epsilon | 92..206 | CDD:198287 | 31/171 (18%) | ||
Gdap1l1 | XP_038961050.1 | Thioredoxin_like | 47..122 | CDD:412351 | 15/74 (20%) |
GST_C_family | 203..313 | CDD:413470 | 18/109 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166348209 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |