DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and Clic4

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_038913.1 Gene:Clic4 / 29876 MGIID:1352754 Length:253 Species:Mus musculus


Alignment Length:170 Identity:34/170 - (20%)
Similarity:74/170 - (43%) Gaps:44/170 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWESRAIAVYLVEKYGKPDSPLYPNDPQKRA 95
            :|:...:|.....|::::::|:|  |.....|..|:..  .:.|:  |..:|::    |:..:|.
Mouse    89 NKIEEFLEEVLCPPKYLKLSPKH--PESNTAGMDIFAK--FSAYI--KNSRPEA----NEALERG 143

  Fly    96 LIN--QRL--YFDMGTLYDALTKYFFLIFRTGKFGDQEALDKVNSAFGFLNTFLEGQDFVAGSQL 156
            |:.  |:|  |.: ..|.|.:              |:.:::.:.         ...:.|:.|.::
Mouse   144 LLKTLQKLDEYLN-SPLPDEI--------------DENSMEDIK---------FSTRRFLDGDEM 184

  Fly   157 TVADIVILATVSTV-----EWFSFDLSK-FPNVERWLKNA 190
            |:||..:|..:..|     ::.:||:.| ...:.|:|.||
Mouse   185 TLADCNLLPKLHIVKVVAKKYRNFDIPKGMTGIWRYLTNA 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 9/45 (20%)
GstA 6..188 CDD:223698 31/166 (19%)
GST_C_Delta_Epsilon 92..206 CDD:198287 22/109 (20%)
Clic4NP_038913.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..101 2/11 (18%)
O-ClC 17..252 CDD:129941 34/170 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844472
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.