DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and Clic3

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001013098.2 Gene:Clic3 / 296566 RGDID:1307249 Length:237 Species:Rattus norvegicus


Alignment Length:220 Identity:49/220 - (22%)
Similarity:76/220 - (34%) Gaps:75/220 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWESRAIAVYLVE 77
            |:.:.:.||....|:......::|.....:..:|.   |...:|.|:.:|.|..::..|..:|.|
  Rat    24 PSCQRLFMVLLLKGVPFTLTTVDTRRALDVLKDFA---PGSQLPILLYDGDVKTDTLQIEEFLEE 85

  Fly    78 KYGKPDSP-LYP---------ND--------------PQKRALINQRLYFDMGTLYDALTKYFFL 118
            ..|.||.| |.|         ||              .|..||..|        |..|||:    
  Rat    86 TLGPPDFPGLAPRYRESNTAGNDIFHKFSAFIKNPVPTQDDALYQQ--------LLRALTR---- 138

  Fly   119 IFRTGKFGDQEALDKVNSAFGFLNTFLEGQ------------DFVAGSQLTVADIVILATVSTVE 171
                        ||:      :|.|.|:.:            .|:.|.|||:||..:|..:..|:
  Rat   139 ------------LDR------YLGTPLDHELAQEPHLSESRRRFLDGDQLTLADCSLLPKLHIVD 185

  Fly   172 WFSFDLSKFP------NVERWLKNA 190
            .......:.|      .|.|:|.:|
  Rat   186 TVCAHFRQRPIPAELSCVRRYLDSA 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 13/63 (21%)
GstA 6..188 CDD:223698 47/216 (22%)
GST_C_Delta_Epsilon 92..206 CDD:198287 27/117 (23%)
Clic3NP_001013098.2 O-ClC 6..230 CDD:129941 49/220 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348165
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.