DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and Clic2

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001009651.1 Gene:Clic2 / 294141 RGDID:1306580 Length:245 Species:Rattus norvegicus


Alignment Length:222 Identity:53/222 - (23%)
Similarity:92/222 - (41%) Gaps:47/222 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PNLDLY--------NFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVR-INPQHTIPT 57
            |.::|:        :....|..:.:.|:....|::.|...|:|..    |||.:: :.|....|.
  Rat    12 PEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTIDTAR----KPEELKDLAPGTNPPF 72

  Fly    58 LVDNGFVIWESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRT 122
            |:.|..:..:...|..:| ||...|  |.||:...|     .:..||:|.  :...|:...|..|
  Rat    73 LIYNKELKTDFIKIEEFL-EKTLAP--PRYPHLSPK-----YKESFDVGC--NLFAKFSAYIKNT 127

  Fly   123 GKFG----DQEALDKVNSAFGFLNT-FLEGQD-------------FVAGSQLTVADIVILATVST 169
            .|..    ::..|.:......:||| .|:..|             |:.|.|||:||..:|..::.
  Rat   128 QKEANKNFEKSLLREFKRLDDYLNTPLLDEIDPDSTEERTLSRRLFLDGDQLTLADCSLLPKLNI 192

  Fly   170 V-----EWFSFDL-SKFPNVERWLKNA 190
            :     ::..||: ::|..|.|:|.||
  Rat   193 IKVAAKKYRDFDIPAEFSGVWRYLHNA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 16/81 (20%)
GstA 6..188 CDD:223698 49/214 (23%)
GST_C_Delta_Epsilon 92..206 CDD:198287 30/123 (24%)
Clic2NP_001009651.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..96 19/88 (22%)
GST_N_CLIC 9..99 CDD:239359 21/93 (23%)
O-ClC 12..245 CDD:129941 53/222 (24%)
GST_C_CLIC2 106..244 CDD:198331 29/116 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348050
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.