Sequence 1: | NP_525114.1 | Gene: | GstD7 / 48340 | FlyBaseID: | FBgn0010043 | Length: | 224 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_741061.2 | Gene: | gst-35 / 259481 | WormBaseID: | WBGene00001783 | Length: | 218 | Species: | Caenorhabditis elegans |
Alignment Length: | 231 | Identity: | 52/231 - (22%) |
---|---|---|---|
Similarity: | 92/231 - (39%) | Gaps: | 55/231 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MPNLDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKP-----EFVRI---NPQHTIPT 57
Fly 58 LVDNGFVIWESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKY---FFLI 119
Fly 120 FRTGKFG-DQEALDKV---------NSAFGFLNTFLEG--QDFVAGSQLTVADIVI---LATVST 169
Fly 170 VEW-------------FSFDLSKFPNVERWLKNAPK 192 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD7 | NP_525114.1 | GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 19/80 (24%) |
GstA | 6..188 | CDD:223698 | 47/220 (21%) | ||
GST_C_Delta_Epsilon | 92..206 | CDD:198287 | 28/132 (21%) | ||
gst-35 | NP_741061.2 | GST_N_Sigma_like | 4..82 | CDD:239337 | 19/80 (24%) |
PTZ00057 | 6..215 | CDD:173353 | 49/224 (22%) | ||
GST_C_Sigma_like | 92..200 | CDD:198301 | 24/115 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X30 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |