DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GSTT4

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001345593.1 Gene:GSTT4 / 25774 HGNCID:26930 Length:241 Species:Homo sapiens


Alignment Length:208 Identity:53/208 - (25%)
Similarity:99/208 - (47%) Gaps:20/208 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWES 68
            |:||...::...||:.:.:|...::.|.:.::.::|......::.|||...:|:|.|..|::.||
Human     3 LELYMDLLSAPCRAVYIFSKKHDIQFNFQFVDLLKGHHHSKGYIDINPLRKLPSLKDGKFILSES 67

  Fly    69 RAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTGKFGDQE---- 129
            .||..||..||..| |...|.||..||.:::.:.:........:.|..:|.....|...:|    
Human    68 AAILYYLCRKYSAP-SHWCPPDPHARARVDEFVAWQHTAFQLPMKKIVWLKLLIPKITGEEVSAE 131

  Fly   130 ----ALDKV-NSAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTVEWFSFDLSKFPNVERWLKN 189
                |:::| ||...|...||:.:.|:.|:|:::||:|  |.|..::..:.:.:.|.|..:..: 
Human   132 KMEHAVEEVKNSLQLFEEYFLQDKMFITGNQISLADLV--AVVEMMQPMAANYNVFLNSSKLAE- 193

  Fly   190 APKVTPGWEQNLE 202
                   |...:|
Human   194 -------WRMQVE 199

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 21/72 (29%)
GstA 6..188 CDD:223698 50/190 (26%)
GST_C_Delta_Epsilon 92..206 CDD:198287 25/120 (21%)
GSTT4NP_001345593.1 Thioredoxin_like 3..78 CDD:320948 21/74 (28%)