DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GstE9

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster


Alignment Length:222 Identity:76/222 - (34%)
Similarity:119/222 - (53%) Gaps:10/222 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPNLDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVI 65
            |..|.||....:|..||.::...||||:...:|:|.:.|:....||...|||||:|.|.|:|..|
  Fly     1 MGKLVLYGVEASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFI 65

  Fly    66 WESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFF--LIFRTGKFGDQ 128
            |||.||..|||.:|.|.|. |||.|..||||::|||:|:.|.|:....:...  |.::......:
  Fly    66 WESHAICAYLVRRYAKSDD-LYPKDYFKRALVDQRLHFESGVLFQGCIRNIAIPLFYKNITEVPR 129

  Fly   129 EALDKVNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVST-VEWFSFDLSKFPNVERWLKNAPK 192
            ..:|.:..|:.||..|:..|.::.|..:|:||..::::||: |...:.|..::|.:..||.....
  Fly   130 SQIDAIYEAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRYPKLNGWLDRMAA 194

  Fly   193 VTPGWEQNLESLQ-QGKKFLQDLQAAK 218
                 :.|.:||. .|.:.|.|:.::|
  Fly   195 -----QPNYQSLNGNGAQMLIDMFSSK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 32/72 (44%)
GstA 6..188 CDD:223698 66/184 (36%)
GST_C_Delta_Epsilon 92..206 CDD:198287 31/117 (26%)
GstE9NP_725784.1 GstA 4..201 CDD:223698 69/202 (34%)
GST_N_Delta_Epsilon 4..76 CDD:239343 31/71 (44%)
GST_C_Delta_Epsilon 92..209 CDD:198287 32/121 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460331
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.