DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and AIMP3

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_660194.1 Gene:AIMP3 / 246507 FlyBaseID:FBgn0050185 Length:179 Species:Drosophila melanogaster


Alignment Length:211 Identity:41/211 - (19%)
Similarity:69/211 - (32%) Gaps:71/211 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IQMVAKALG-----LELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFV-IWESRAIAVYLV 76
            :|.:|..||     ::||.:.:.|....|.|..               .||. |.||.|      
  Fly     7 VQKIANCLGVNPGKVQLNEEQVVTRTSGQKKSV---------------AGFASILESLA------ 50

  Fly    77 EKYGKPDSPLYPNDPQKRALINQRLY--FDMGTLYDALTKYFFLIFRTGKFGDQEALDKVNSAFG 139
               .:..|....|....|. :..::|  .:...||.|...       ..|:..::.|...|..|.
  Fly    51 ---SESKSETAQNSRASRE-VEAQVYQWIEFSVLYVAPGS-------KDKYVSKQLLADFNKLFA 104

  Fly   140 FLNTFLEGQDFVAGSQLTVADIVILATVSTVEWFSFDLSK---------FPNVERWLKNAPKVTP 195
                   .:.::.|..:|:||:.:...:       :||.|         :.|:.||..:.     
  Fly   105 -------SKSYLVGHFITLADLAVYYAI-------YDLVKSLSPVDKEVYLNLSRWFDHL----- 150

  Fly   196 GWEQNLESLQQGKKFL 211
               ||...:.||:..|
  Fly   151 ---QNRADVHQGEPLL 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 15/64 (23%)
GstA 6..188 CDD:223698 36/186 (19%)
GST_C_Delta_Epsilon 92..206 CDD:198287 21/124 (17%)
AIMP3NP_660194.1 GST_C_AIMP3 65..166 CDD:198338 24/129 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.