Sequence 1: | NP_525114.1 | Gene: | GstD7 / 48340 | FlyBaseID: | FBgn0010043 | Length: | 224 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_035820.3 | Gene: | Vars / 22321 | MGIID: | 90675 | Length: | 1263 | Species: | Mus musculus |
Alignment Length: | 216 | Identity: | 45/216 - (20%) |
---|---|---|---|
Similarity: | 69/216 - (31%) | Gaps: | 51/216 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 PQHTIPTLVD--NGFVIWESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRL-YFDMGTLYDAL 112
Fly 113 TKYFFLIFRTGKFGD-QEALDKVNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTVEWFSFD 176
Fly 177 LSK---FPNVERWLKN--------------------------------APKVTPGW-------EQ 199
Fly 200 NLESLQQGKKFLQDLQAAKEK 220 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD7 | NP_525114.1 | GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 8/27 (30%) |
GstA | 6..188 | CDD:223698 | 34/143 (24%) | ||
GST_C_Delta_Epsilon | 92..206 | CDD:198287 | 30/157 (19%) | ||
Vars | NP_035820.3 | GST_C_family | 92..213 | CDD:383119 | 24/120 (20%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 218..294 | 11/46 (24%) | |||
PTZ00419 | 281..1263 | CDD:240411 | |||
'HIGH' region | 343..353 | ||||
'KMSKS' region | 861..865 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |