DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and eef1g

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_775370.1 Gene:eef1g / 195822 ZFINID:ZDB-GENE-020423-3 Length:442 Species:Danio rerio


Alignment Length:237 Identity:62/237 - (26%)
Similarity:103/237 - (43%) Gaps:28/237 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYNFPMAPASRAIQMVAKALGLELNSKLIN-----TMEGDQLKPEFVRINPQHTIPTLV-DNGFV 64
            ||.||....:...|:.|:..|..|  |:.:     |.......|.|:...|...:|... |:||.
Zfish     6 LYTFPENWRAFKAQIAAQYSGARL--KIASAPPAFTFGQTNRSPAFLGNFPLGKVPAYQGDDGFC 68

  Fly    65 IWESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFL---IFRTGKFG 126
            ::||.|||.||      .:..|..:.||..|.:.|.:.|....:....:.:.|.   |.:..|..
Zfish    69 LFESNAIAHYL------SNDVLRGSTPQASAQVLQWVSFADSEVIPPASAWVFPTLGIMQFNKQA 127

  Fly   127 DQEALDKVNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTVEWFSFDLS---KFPNVERWL- 187
            .::|.::|......||..|..:.|:.|.::::|||.::.::..:.....:|:   .:|||.||. 
Zfish   128 TEQAKEEVKRVLAVLNQHLNTRTFLVGERISLADITVVCSLLWLYKQVLELAFRQPYPNVTRWFV 192

  Fly   188 --KNAP--KVTPGWEQNLESLQQ--GKKFLQDLQAAKEKEVK 223
              .|.|  |...|..:..|.:.|  .||| .::|..||..:|
Zfish   193 TCVNQPQFKTVLGEVKLCEKMAQFDAKKF-AEMQPKKEAPIK 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 24/76 (32%)
GstA 6..188 CDD:223698 49/196 (25%)
GST_C_Delta_Epsilon 92..206 CDD:198287 28/124 (23%)
eef1gNP_775370.1 GST_N_EF1Bgamma 4..82 CDD:239342 24/83 (29%)
maiA 5..201 CDD:273527 51/202 (25%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 27/121 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..273 3/7 (43%)
EF1G 280..386 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.