DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and gst-43

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_491070.1 Gene:gst-43 / 190586 WormBaseID:WBGene00001791 Length:214 Species:Caenorhabditis elegans


Alignment Length:185 Identity:50/185 - (27%)
Similarity:85/185 - (45%) Gaps:7/185 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYNFPMAPASRAIQMVAKALGLELNSKLINTM-EGDQLKPEFVRINPQHTIPTLVDNGFVIWESR 69
            ||::..:..:..:::......::...:.|:.. |..:...|||:.||...:||||.||..:.||.
 Worm     6 LYSYWRSSCAWRVRIALALKNIDYEYRPIDLFSEESKNNAEFVKHNPAKKVPTLVINGLSLTESL 70

  Fly    70 AIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTL--YDALTKYFFLIFRTGKFGDQEALD 132
            ||..||.|.|  ||.|..|.:..||:.........:.::  ..|:..:..|..:...:||.....
 Worm    71 AIIEYLDEAY--PDPPFLPKELDKRSYSRAIALHIVASIQPLQAINIHKMLNEKEPGYGDFWCNH 133

  Fly   133 KVNSAFGFLNTFLEGQD--FVAGSQLTVADIVILATVSTVEWFSFDLSKFPNVER 185
            .||..|..|...|:...  :..|.|||:|||.:.:.:...:.:..|:||:|.:.|
 Worm   134 FVNKGFLALEELLKKHSGKYCVGDQLTIADINLPSIIYNAKIYKVDMSKYPTITR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 21/71 (30%)
GstA 6..188 CDD:223698 50/185 (27%)
GST_C_Delta_Epsilon 92..206 CDD:198287 23/98 (23%)
gst-43NP_491070.1 GST_N_Zeta 4..77 CDD:239340 20/70 (29%)
maiA 5..211 CDD:273527 50/185 (27%)
GST_C_Zeta 90..207 CDD:198300 23/99 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163429
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.