DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and gst-27

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_497116.1 Gene:gst-27 / 175166 WormBaseID:WBGene00001775 Length:209 Species:Caenorhabditis elegans


Alignment Length:165 Identity:38/165 - (23%)
Similarity:67/165 - (40%) Gaps:42/165 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PTLVDNGFVIWESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIF 120
            |.|..:||.|.:|.||..||.:::|...     ..|:::|..:        .:.|....:...|.
 Worm    54 PVLSVDGFEIPQSAAINRYLAKQFGYAG-----KTPEEQAWTD--------AIVDQYKDFMVSIK 105

  Fly   121 RTGKFG----DQEALDKV---------NSAFGFLNTFLE--GQDFVAGSQLTVADIVILATVSTV 170
            ..||..    ..|.:.|:         ::.|..:|..||  ...|:.|..||:|||||:..::|:
 Worm   106 EVGKASAAGKSAEEVGKIIQSDLVPARDAFFVIINKILEKSKSGFLVGDGLTIADIVIVECITTL 170

  Fly   171 EWFS-FDLSK-------------FPNVERWLKNAP 191
            :... |..|:             .|.:::|::..|
 Worm   171 DKHQLFTASEQPKLVALREKVYAIPAIKKWVEIRP 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 10/20 (50%)
GstA 6..188 CDD:223698 37/160 (23%)
GST_C_Delta_Epsilon 92..206 CDD:198287 26/129 (20%)
gst-27NP_497116.1 GST_N_Sigma_like 4..75 CDD:239337 10/20 (50%)
PTZ00057 6..208 CDD:173353 38/165 (23%)
GST_C_Sigma_like 85..191 CDD:198301 23/113 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.