DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and Gstz1

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_034493.1 Gene:Gstz1 / 14874 MGIID:1341859 Length:216 Species:Mus musculus


Alignment Length:183 Identity:50/183 - (27%)
Similarity:87/183 - (47%) Gaps:9/183 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYNFPMAPASRAIQMVAKALGLELNSKLINTME--GDQLKPEFVRINPQHTIPTLVDNGFVIWES 68
            ||::..:..|..:::.....|::.....||.::  |.|...||..:||...:|.|..:|..|.:|
Mouse     8 LYSYFRSSCSWRVRIALALKGIDYEIVPINLIKDGGQQFTEEFQTLNPMKQVPALKIDGITIVQS 72

  Fly    69 RAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTGKFGDQEALDK 133
            .||..||.|.  :|...|.|.||||||::  |:..|:........:...::.:.|:....:...|
Mouse    73 LAIMEYLEET--RPIPRLLPQDPQKRAIV--RMISDLIASGIQPLQNLSVLKQVGQENQMQWAQK 133

  Fly   134 V-NSAFGFLNTFLEGQ--DFVAGSQLTVADIVILATVSTVEWFSFDLSKFPNV 183
            | .|.|..|...|:..  .:..|.::::||:.::..|:..|.|..|||.:|.:
Mouse   134 VITSGFNALEKILQSTAGKYCVGDEVSMADVCLVPQVANAERFKVDLSPYPTI 186

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 21/72 (29%)
GstA 6..188 CDD:223698 50/183 (27%)
GST_C_Delta_Epsilon 92..206 CDD:198287 23/95 (24%)
Gstz1NP_034493.1 GST_N_Zeta 6..80 CDD:239340 20/71 (28%)
maiA 7..211 CDD:273527 50/183 (27%)
Glutathione binding 14..19 1/4 (25%)