DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and Gstt1

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_032211.3 Gene:Gstt1 / 14871 MGIID:107379 Length:240 Species:Mus musculus


Alignment Length:174 Identity:51/174 - (29%)
Similarity:83/174 - (47%) Gaps:18/174 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWES 68
            |:||...::...|||.:.||...:......:...:|:.|...|.|:||...:|.::|.||.:.||
Mouse     3 LELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDGGFTLCES 67

  Fly    69 RAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFD-MGTLYDALT----KYFFLIFRTGKFGDQ 128
            .||.:||..||..||. .||.|.|.||.:::.|.:. .|.....|.    |..|.:|    .|:|
Mouse    68 VAILLYLAHKYKVPDH-WYPQDLQARARVDEYLAWQHTGLRRSCLRALWHKVMFPVF----LGEQ 127

  Fly   129 EALDKVNSAFGFLNT--------FLEGQDFVAGSQLTVADIVIL 164
            ...:.:.:....|:.        ||:.:||:.|..:::||:|.:
Mouse   128 IPPETLAATLAELDVNLQVLEDKFLQDKDFLVGPHISLADLVAI 171

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 24/72 (33%)
GstA 6..188 CDD:223698 50/172 (29%)
GST_C_Delta_Epsilon 92..206 CDD:198287 20/86 (23%)
Gstt1NP_032211.3 GstA 3..212 CDD:223698 51/174 (29%)
GST_N_Theta 3..78 CDD:239348 24/74 (32%)