DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and Gdap1

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_034397.1 Gene:Gdap1 / 14545 MGIID:1338002 Length:358 Species:Mus musculus


Alignment Length:222 Identity:43/222 - (19%)
Similarity:87/222 - (39%) Gaps:52/222 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NLDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVIWE 67
            :|.||::..:.:|:.:::|.....|:.....::....:..:|.|:|:|....:|.||....:|.|
Mouse    25 HLILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPLSEHNEPWFMRLNSAGEVPVLVHGENIICE 89

  Fly    68 SRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTGKFGDQEALD 132
            :..|..||.:.:....:|              ||..|.|::|....:::           :|.||
Mouse    90 ATQIIDYLEQTFLDERTP--------------RLMPDEGSMYYPRVQHY-----------RELLD 129

  Fly   133 KVNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTVEWFSFDLSKFPNVERWLKNAPKVTPGW 197
            .:.     ::.:..|  .:...:|||..::.....:.:.      |:..|.|..||...:..|. 
Mouse   130 SLP-----MDAYTHG--CILHPELTVDSMIPAYATTRIR------SQIGNTESELKKLAEENPD- 180

  Fly   198 EQNLESLQQGKKFLQDLQAAKEKEVKA 224
                         ||:...||:|.:|:
Mouse   181 -------------LQEAYIAKQKRLKS 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 18/72 (25%)
GstA 6..188 CDD:223698 33/181 (18%)
GST_C_Delta_Epsilon 92..206 CDD:198287 18/113 (16%)
Gdap1NP_034397.1 GST_N_GDAP1 26..98 CDD:239350 17/71 (24%)
GST_C_GDAP1 179..289 CDD:198336 7/30 (23%)
Required for mitochondrial localization. /evidence=ECO:0000250 320..358
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844787
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.