DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and GSTO2

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_899062.1 Gene:GSTO2 / 119391 HGNCID:23064 Length:243 Species:Homo sapiens


Alignment Length:225 Identity:56/225 - (24%)
Similarity:91/225 - (40%) Gaps:44/225 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYNFPMAPASRAIQMVAKALGLE---LNSKLINTMEGDQLKPE-FVRINPQHTIPTL-VDNGFVI 65
            :|:....|.|...::|.||..:.   :|..|.|       ||| :...:|...||.| .....:|
Human    26 IYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRN-------KPEWYYTKHPFGHIPVLETSQCQLI 83

  Fly    66 WESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTGKFGDQEA 130
            :||.....||.:.|  |...|:|.||.:||  .|::..::......|||...:..|.|:    |.
Human    84 YESVIACEYLDDAY--PGRKLFPYDPYERA--RQKMLLELFCKVPHLTKECLVALRCGR----EC 140

  Fly   131 LD---KVNSAFGFLNTFLEGQD--FVAGSQLTVADIVILATVSTVEWFS-------FD-LSKFPN 182
            .:   .:...|..|...||.|:  |..|:.:::.|.::.      .||.       .| :|..|.
Human   141 TNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLW------PWFERLDVYGILDCVSHTPA 199

  Fly   183 VERWLKNAPKVTPGWEQNLESLQQGKKFLQ 212
            :..|: :|.|    |:..:.:|...|...|
Human   200 LRLWI-SAMK----WDPTVCALLMDKSIFQ 224

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 21/75 (28%)
GstA 6..188 CDD:223698 50/199 (25%)
GST_C_Delta_Epsilon 92..206 CDD:198287 27/126 (21%)
GSTO2NP_899062.1 Thioredoxin_like 7..94 CDD:320948 20/74 (27%)