DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and CLIC2

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001280.3 Gene:CLIC2 / 1193 HGNCID:2063 Length:247 Species:Homo sapiens


Alignment Length:223 Identity:50/223 - (22%)
Similarity:89/223 - (39%) Gaps:49/223 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PNLDLY--------NFPMAPASRAIQMVAKALGLELNSKLIN-TMEGDQLKPEFVRINPQHTIPT 57
            |.::|:        :....|..:.:.|:....|::.|...:: |.:.::||......||    |.
Human    12 PEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNP----PF 72

  Fly    58 LVDNGFVIWESRAIAVYLVEKYGKPDSP-LYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFR 121
            ||.|..:..:...|..:|.:....|..| |.|...:.         ||:|.  :...|:...|..
Human    73 LVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKES---------FDVGC--NLFAKFSAYIKN 126

  Fly   122 TGKFG----DQEALDKVNSAFGFLNT-FLEGQD-------------FVAGSQLTVADIVILATVS 168
            |.|..    ::..|.:......:||| .|:..|             |:.|.|||:||..:|..::
Human   127 TQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLN 191

  Fly   169 TV-----EWFSFDL-SKFPNVERWLKNA 190
            .:     ::..||: ::|..|.|:|.||
Human   192 IIKVAAKKYRDFDIPAEFSGVWRYLHNA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 16/81 (20%)
GstA 6..188 CDD:223698 46/215 (21%)
GST_C_Delta_Epsilon 92..206 CDD:198287 29/123 (24%)
CLIC2NP_001280.3 Required for insertion into the membrane. /evidence=ECO:0000250 1..96 17/87 (20%)
N-terminal 1..94 17/85 (20%)
O-ClC 12..245 CDD:129941 50/223 (22%)
Joint loop 95..106 4/10 (40%)
C-terminal 107..247 29/124 (23%)
Foot loop 151..171 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154399
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.