Sequence 1: | NP_525114.1 | Gene: | GstD7 / 48340 | FlyBaseID: | FBgn0010043 | Length: | 224 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001274522.1 | Gene: | CLIC1 / 1192 | HGNCID: | 2062 | Length: | 241 | Species: | Homo sapiens |
Alignment Length: | 204 | Identity: | 47/204 - (23%) |
---|---|---|---|
Similarity: | 81/204 - (39%) | Gaps: | 41/204 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 PASRAIQMVAKALGLELNSKLINTMEGDQLKPEFV-RINPQHTIPTLVDNGFVIWESRAIAVYLV 76
Fly 77 EKYGKPDSPLYPNDPQKRALINQRLYFDMGTL-YDALTKYFFLIFRTGKFGDQEALDKVNSAFGF 140
Fly 141 LNTFL---------------EG---QDFVAGSQLTVADIVILATVSTVE-----WFSFDLSK-FP 181
Fly 182 NVERWLKNA 190 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD7 | NP_525114.1 | GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 15/64 (23%) |
GstA | 6..188 | CDD:223698 | 44/200 (22%) | ||
GST_C_Delta_Epsilon | 92..206 | CDD:198287 | 27/124 (22%) | ||
CLIC1 | NP_001274522.1 | Required for insertion into the membrane | 2..90 | 16/69 (23%) | |
O-ClC | 6..241 | CDD:129941 | 47/204 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165154489 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |