DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and CLIC1

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001274522.1 Gene:CLIC1 / 1192 HGNCID:2062 Length:241 Species:Homo sapiens


Alignment Length:204 Identity:47/204 - (23%)
Similarity:81/204 - (39%) Gaps:41/204 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PASRAIQMVAKALGLELNSKLINTMEGDQLKPEFV-RINPQHTIPTLVDNGFVIWESRAIAVYLV 76
            |.|:.:.||....|:..|...::|    :.:.|.| ::.|...:|.|:....|..::..|..:| 
Human    25 PFSQRLFMVLWLKGVTFNVTTVDT----KRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFL- 84

  Fly    77 EKYGKPDSPLYPNDPQKRALINQRLYFDMGTL-YDALTKYFFLIFRTGKFGDQEALDKVNSAFGF 140
            |....|  |.||    |.|.:|.    :..|. .|...|:...|..:....:......:..|...
Human    85 EAVLCP--PRYP----KLAALNP----ESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKV 139

  Fly   141 LNTFL---------------EG---QDFVAGSQLTVADIVILATVSTVE-----WFSFDLSK-FP 181
            |:.:|               ||   :.|:.|::||:||..:|..:..|:     :..|.:.: |.
Human   140 LDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFR 204

  Fly   182 NVERWLKNA 190
            .|.|:|.||
Human   205 GVHRYLSNA 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 15/64 (23%)
GstA 6..188 CDD:223698 44/200 (22%)
GST_C_Delta_Epsilon 92..206 CDD:198287 27/124 (22%)
CLIC1NP_001274522.1 Required for insertion into the membrane 2..90 16/69 (23%)
O-ClC 6..241 CDD:129941 47/204 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154489
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.