DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD7 and gstz1

DIOPT Version :9

Sequence 1:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_002938913.1 Gene:gstz1 / 100145591 XenbaseID:XB-GENE-978910 Length:216 Species:Xenopus tropicalis


Alignment Length:216 Identity:52/216 - (24%)
Similarity:102/216 - (47%) Gaps:26/216 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYNFPMAPASRAIQMVAKALGLELNSKLINTME--GDQLKPEFVRINPQHTIPTLVDNGFVIWES 68
            ||.:..:..|..:::.....|:|.:.::||.::  |.||..|:.::||...:|.|..:|..:.:|
 Frog     9 LYGYFRSSCSWRVRIALAFKGIEYDQQVINLVKDGGMQLSNEYKQVNPMQQVPALCIDGVTLSQS 73

  Fly    69 RAIAVYLVEKYGKPDSPLYPNDPQKRA---LINQRLYFDMGTLYDALTKYFFLIFRTGKFGDQEA 130
            .||..||.|.  :|:.||.|.||:|||   :|:.::...:..|.:     ..::.:.|:...:.|
 Frog    74 LAIIEYLEET--RPNPPLLPRDPKKRAQVRMISDQIASGIQPLQN-----LCVLQKIGETKLEWA 131

  Fly   131 LDKVNSAFGFLNTFLE---GQDFVAGSQLTVADIVILATVSTVEWFSFDLSKFPNV--------- 183
            ...:...|..|...|:   |: :..|.::|:||:.::..|:....|..||:.:|.:         
 Frog   132 KHFITRGFQALEKLLQTTAGR-YCVGDEVTIADLCLVPQVANAVRFKVDLAPYPTIVGINESLLQ 195

  Fly   184 -ERWLKNAPKVTPGWEQNLES 203
             |.:..:.|...|...:.|.:
 Frog   196 LEAFQVSHPSCQPDTPEELRA 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 21/72 (29%)
GstA 6..188 CDD:223698 49/199 (25%)
GST_C_Delta_Epsilon 92..206 CDD:198287 24/128 (19%)
gstz1XP_002938913.1 maiA 8..211 CDD:273527 51/209 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.