DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and grxB

DIOPT Version :10

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_415582.1 Gene:grxB / 946926 ECOCYCID:EG12688 Length:215 Species:Escherichia coli


Alignment Length:139 Identity:35/139 - (25%)
Similarity:53/139 - (38%) Gaps:53/139 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 KDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGK--PGTQENLEKLN--------- 131
            ||||.|.  |:...:::   |.|.   .||     .||| |||  |..:|.|.|:|         
E. coli    53 KDDSRYM--PESMDIVH---YVDK---LDG-----KPLL-TGKRSPAIEEWLRKVNGYANKLLLP 103

  Fly   132 ----AAFDLLNN------FLDGQDYVAGN-----------------QLSVAD-IVILATVSTTEM 168
                :|||..:.      |:|.::..|||                 .|...| :::.......|:
E. coli   104 RFAKSAFDEFSTPAARKYFVDKKEASAGNFADLLAHSDGLIKNISDDLRALDKLIVKPNAVNGEL 168

  Fly   169 VDFDLKKFP 177
            .:.|::.||
E. coli   169 SEDDIQLFP 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343
GST_C_Delta_Epsilon 88..204 CDD:198287 29/129 (22%)
grxBNP_415582.1 PRK10387 1..210 CDD:236679 35/139 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.