DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and Clic5

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_446055.1 Gene:Clic5 / 94272 RGDID:620659 Length:251 Species:Rattus norvegicus


Alignment Length:198 Identity:43/198 - (21%)
Similarity:80/198 - (40%) Gaps:51/198 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DLYNMSGSPSTRAVMMTAKA-VGVEFNSIQVNTFVGEQLEP-WFVKINPQHTIPTLVDNLFVIWE 64
            ||:|:  :|.|....:|... |..:.|.|:  .|:.|.|.| .:.|:..:|.            |
  Rat    62 DLHNL--APGTHPPFLTFNGDVKTDVNKIE--EFLEETLTPEKYPKLAARHR------------E 110

  Fly    65 TRAIVVYLVEQYGKDDSLYPKDPQKQ--ALINQRLYFDMGTLYDGIAKYFFPLLRTGKPGTQENL 127
            :....:.:..::    |.|.|:.::|  |.:.:.|...:..|.|.:.......:.|...|.::..
  Rat   111 SNTAGIDIFSKF----SAYIKNTKQQNNAALERGLTKALRKLDDYLNTPLPEEIDTNTHGDEKGS 171

  Fly   128 EKLNAAFDLLNNFLDGQDYVAGNQLSVADIVILATVSTTEMVDFDLKKFPNVD---------RWY 183
            ::         .|||      |::|::||..:|..:...::|   .||:.|.|         |:.
  Rat   172 QR---------KFLD------GDELTLADCNLLPKLHVVKIV---AKKYRNYDIPAEMTGLWRYL 218

  Fly   184 KNA 186
            |||
  Rat   219 KNA 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 16/73 (22%)
PLN02395 11..208 CDD:166036 39/189 (21%)
GST_C_Delta_Epsilon 88..204 CDD:198287 24/110 (22%)
Clic5NP_446055.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..98 12/39 (31%)
O-ClC 14..249 CDD:129941 43/198 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348228
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.