DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and CLIC3

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_004660.2 Gene:CLIC3 / 9022 HGNCID:2064 Length:236 Species:Homo sapiens


Alignment Length:225 Identity:44/225 - (19%)
Similarity:83/225 - (36%) Gaps:54/225 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVK-INPQHTIPTLVDNLFVIWETRAIVVYLV 73
            ||.:.:.|.....||.|....|:|    :..|..:| ..|...:|.|:.:.....:|..|..:|.
Human    23 PSCQRLFMVLLLKGVPFTLTTVDT----RRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLE 83

  Fly    74 EQYGKDD--SLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGKPGTQENL-EKLNAAFD 135
            |..|..|  ||.|:            |.:..|..:.:...|...::...|...|.| ::|..|..
Human    84 ETLGPPDFPSLAPR------------YRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALA 136

  Fly   136 LLNNFL----------------DGQDYVAGNQLSVADIVILATVSTTEMVDFDLKKFPNVDRWYK 184
            .|:::|                ..:.::.|::|::||..:|..:...:.|....::.|       
Human   137 RLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAP------- 194

  Fly   185 NAQKVTPGWDENLARIQSAKKFLAENLIEK 214
                 .|      |.::..:::|...:.||
Human   195 -----IP------AELRGVRRYLDSAMQEK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 16/64 (25%)
PLN02395 11..208 CDD:166036 40/216 (19%)
GST_C_Delta_Epsilon 88..204 CDD:198287 19/132 (14%)
CLIC3NP_004660.2 Required for insertion into the membrane. /evidence=ECO:0000250 1..88 17/68 (25%)
PLN02817 5..229 CDD:330276 44/225 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154444
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.