DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and CAM1

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_015277.1 Gene:CAM1 / 856059 SGDID:S000005969 Length:415 Species:Saccharomyces cerevisiae


Alignment Length:177 Identity:44/177 - (24%)
Similarity:68/177 - (38%) Gaps:45/177 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FVKINPQHTIPTLV-DNLFVIWETRAIVVYLV----------EQYGKDDSLYPKDP--QKQALIN 94
            |.:..|...:|..| ...:.:.|..||..|||          :..|.||.|..:..  :.|:|.|
Yeast    40 FARDFPLKKVPAFVGPKGYKLTEAMAINYYLVKLSQDDKMKTQLLGADDDLNAQAQIIRWQSLAN 104

  Fly    95 QRLYFDMGTLYDGIAKYFFPLLRTGKPGTQENLEKLNAAF-------DLLNNFLDGQDYVAGNQL 152
            ..|...       ||....||    |.|...|.:.:::|.       |:..|.|....|:|...:
Yeast   105 SDLCIQ-------IANTIVPL----KGGAPYNKKSVDSAMDAVDKIVDIFENRLKNYTYLATENI 158

  Fly   153 SVADIVILATVST--------TEMVDFDLKKFPNVDRWYKNAQKVTP 191
            |:||:| .|::.|        ||.    ..:.|.:.||: |..:.:|
Yeast   159 SLADLV-AASIFTRYFESLFGTEW----RAQHPAIVRWF-NTVRASP 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 10/41 (24%)
PLN02395 11..208 CDD:166036 44/177 (25%)
GST_C_Delta_Epsilon 88..204 CDD:198287 30/119 (25%)
CAM1NP_015277.1 GST_N_EF1Bgamma 4..73 CDD:239342 10/32 (31%)
GST_C_EF1Bgamma_like 92..214 CDD:198290 30/125 (24%)
EF1G 255..359 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345063
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.