DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and TEF4

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_012842.1 Gene:TEF4 / 853781 SGDID:S000001564 Length:412 Species:Saccharomyces cerevisiae


Alignment Length:161 Identity:36/161 - (22%)
Similarity:60/161 - (37%) Gaps:26/161 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ETRAIVVYLVEQYGKDDS---LYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGKPGTQE 125
            |..||..||..|...:..   |...|..:::.|.:........:...||:.|...    |.....
Yeast    61 EALAIQFYLANQVADEKERARLLGSDVIEKSQILRWASLANSDVMSNIARPFLSF----KGLIPY 121

  Fly   126 NLEKLNAAFDLLNNF-------LDGQDYVAGNQLSVADIVI-------LATVSTTEMVDFDLKKF 176
            |.:.::|.|..::|.       |....:||...:|:.|:..       |||:...|.    ..|.
Yeast   122 NKKDVDACFVKIDNLAAVFDARLRDYTFVATENISLGDLHAAGSWAFGLATILGPEW----RAKH 182

  Fly   177 PNVDRWYKNAQKVTPGWDENLARIQSAKKFL 207
            |::.||: |....:|......|.::.|:|.|
Yeast   183 PHLMRWF-NTVAASPIVKTPFAEVKLAEKAL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 5/9 (56%)
PLN02395 11..208 CDD:166036 36/161 (22%)
GST_C_Delta_Epsilon 88..204 CDD:198287 25/129 (19%)
TEF4NP_012842.1 GST_N_EF1Bgamma 4..72 CDD:239342 5/10 (50%)
GST_C_EF1Bgamma_like 89..211 CDD:198290 26/130 (20%)
EF1G 253..356 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345073
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.