DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and AT1G66235

DIOPT Version :10

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_683473.2 Gene:AT1G66235 / 842939 AraportID:AT1G66235 Length:284 Species:Arabidopsis thaliana


Alignment Length:78 Identity:15/78 - (19%)
Similarity:26/78 - (33%) Gaps:17/78 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 QKQALINQRLYFDMGTLYDGI----------------AKYFFPLLRTGKPGTQENLEKLNAAFDL 136
            |.:.::.|..:|..|..:|.:                ||....|.....|......:..:.:|..
plant    98 QAKEMLMQDKHFKSGWKFDHVWNIIRNFEKFKDGATQAKKVLNLCGLENPTLDSVSQASSGSFSF 162

  Fly   137 LNNFLDGQDYVAG 149
            ..| ||.:|.:.|
plant   163 SLN-LDDEDDIIG 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343
GST_C_Delta_Epsilon 88..204 CDD:198287 15/78 (19%)
AT1G66235NP_683473.2 NAM-associated 114..266 CDD:464129 11/62 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.