DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and clic3

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_955818.1 Gene:clic3 / 84040 ZFINID:ZDB-GENE-010507-2 Length:239 Species:Danio rerio


Alignment Length:235 Identity:59/235 - (25%)
Similarity:90/235 - (38%) Gaps:48/235 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVK-INPQHTIPTLVDNLFVIWETRAI 68
            ::...|..:.:.|.....||.|..    |.|..:..|..:| :.|....|.|:.|..|..:|..|
Zfish    19 SVGNCPFCQRLFMILWLKGVNFTL----TTVDMKRAPEVLKDLAPGSQPPFLIYNGEVRTDTNKI 79

  Fly    69 VVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGKPGTQENLEK--LN 131
            ..:|      :|:|.|  ||...|..:  |.:..|..|.|...|...::...||..:.|||  |.
Zfish    80 EEFL------EDTLAP--PQYPKLCCR--YKESNTAGDDIFHKFSAYIKNPNPGLNDMLEKKFLK 134

  Fly   132 AAFDL-------LNNFLD--------GQDYVAGNQLSVADIVILATVSTTEMV-----DFD---- 172
            :...|       |.:.||        .:.|:.||.||:||..:|..:...::|     .|:    
Zfish   135 SLMKLDQYLLTPLPHELDQNPELSTSTRHYLDGNALSLADCNLLPKLHIVKVVCKKYRGFEIPAE 199

  Fly   173 ---LKKFPNVDRWYKN--AQKVTPGWDENLARIQSAKKFL 207
               |.|:  :|:.||.  .....|...|.|....|..|:|
Zfish   200 LKGLSKY--LDKAYKEDVFHLTCPKDKEILLAYSSVAKYL 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 17/69 (25%)
PLN02395 11..208 CDD:166036 58/229 (25%)
GST_C_Delta_Epsilon 88..204 CDD:198287 36/146 (25%)
clic3NP_955818.1 GST_N_CLIC 3..92 CDD:239359 21/84 (25%)
O-ClC 6..237 CDD:129941 58/233 (25%)
GST_C_CLIC3 99..231 CDD:198332 33/133 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589605
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.